PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G072500.1
Common NamePOPTR_0012s07450g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 369aa    MW: 41341.5 Da    PI: 5.8069
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G072500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.38.3e-141470148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.........TTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.........kgRtlkqcksrwqkyl 48
                        rg WT+eEd + +  v+++G+g+W++++++           + R++k+c++rw +yl
  Potri.012G072500.1 14 RGLWTAEEDAKMLAHVAKHGTGNWTAVPKKAAfhkrecfagLQRCGKSCRLRWTNYL 70
                        788****************************************************97 PP

2Myb_DNA-binding43.76.3e-1478118345
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         ++T++E+e ++++++  G++ W+ Ia+ ++ gRt++++k++w+
  Potri.012G072500.1  78 SFTPQEEEMIIRLHAAIGSR-WSIIAQQLP-GRTDNDVKNYWN 118
                         79******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.6E-24573IPR009057Homeodomain-like
PROSITE profilePS5129413.686970IPR017930Myb domain
SuperFamilySSF466895.87E-2911117IPR009057Homeodomain-like
SMARTSM007172.1E-101372IPR001005SANT/Myb domain
PfamPF002492.1E-121470IPR001005SANT/Myb domain
CDDcd001671.55E-91770No hitNo description
PROSITE profilePS5129422.57471125IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2474125IPR009057Homeodomain-like
SMARTSM007174.1E-1375123IPR001005SANT/Myb domain
PfamPF002491.0E-1278118IPR001005SANT/Myb domain
CDDcd001677.68E-1078118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MVRPPCCDKL NVKRGLWTAE EDAKMLAHVA KHGTGNWTAV PKKAAFHKRE CFAGLQRCGK  60
SCRLRWTNYL RPDLKHDSFT PQEEEMIIRL HAAIGSRWSI IAQQLPGRTD NDVKNYWNAR  120
LRKKLSEMGI DPVTHKPFSK ILADYGNIGG LVKYGSRIGS LSRGLKNVFT LKPEQYPFTP  180
EGMSNINSHL MTTTVPPKME SNQECFLNIM YNNDANNNHS LDLLDQLQAI RLVTEASSTC  240
TAYQTIPAPC ILDESSTSFS WCDFLLEDEY LPGDHPQAEQ ENAAEFSSKD LTNQTQNPNV  300
MIPQSFQSNT EVNAGVNGMD LALQSNTGSD DQVASSSSQH SSFVETIMDG ESKIFLDFPN  360
LLEEIFYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27141257108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318003.20.0putative MYB transcription factor family protein
TrEMBLB9I3280.0B9I328_POPTR; Putative MYB transcription factor family protein
STRINGPOPTR_0012s07450.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.13e-74MYB family protein